Halothece sp. pcc 7418
WebHydDB. Classify Browse Information Pages WebHalothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)) (NCBI taxonomy ID 65093) Length: 700 amino acids Reference Proteome: Please note: when we start each new Pfam data release, we take a copy of the UniProt sequence database. This snapshot of UniProt forms the basis of the overview that you see here.
Halothece sp. pcc 7418
Did you know?
WebJan 26, 2024 · Ngoennet S, Honda M, Patipong T, Hibino T, Waditee-Sirisattha R, Kageyama H (2024) The effects of salts and osmoprotectants on enzyme activities of fructose-1,6-biphosphate aldolases in a … WebShaniece Heath, LMSW is a counselor in Brooklyn, NY. She currently practices at Beverley Mack Harry Consulting Services Inc..
WebHopeHealth in Lake City provides quality primary health care that is accessible and affordable for individuals of all ages. HopeHealth in Lake City integrates a range of … WebJul 29, 2015 · In addition, by phylogenetic tree analysis, all hox genes in A. halophytica showed a very close relationship with all hox genes in Halothece sp. PCC 7418 (data not shown). The results suggested that the studied cyanobacterium A. halophytica is in the same genus and species as Halothece sp. PCC7418 but might be different in strain or at ...
WebApr 1, 2024 · A class I fructose-1,6-bisphosphate aldolase is associated with salt stress tolerance in a halotolerant cyanobacterium Halothece sp. PCC 7418. Archives of Biochemistry and Biophysics 2024-09 Journal article DOI: 10.1016/j.abb.2024.07.024 Part of ISSN: 0003-9861 Show more detail ... WebDownload alignment. Pentapeptide repeats (8 copies) These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A (D/N)LXX, where X can be any amino acid.
WebAug 2, 2024 · The most related strain in culture is Halothece sp. PCC 7418 and this was used as the test organism in this study. In the Mediterranean Sea, phosphorus (P) and iron (Fe) can be the major limiting ...
Web>SOLUE06479 Q01S10 OMAGroup:967577 [Solibacter usitatus (strain Ellin6076)] MDNSVFYLIYSSSAIRLLSDEELQAIHTRASEGNQRRGITGFLLYRGGNFMQLLEGEETTVRGLFEKIKSDPRHKDVYVL ... cedar rapids iowa inmate listWeb1 SRI International. Summary: This Pathway/Genome Database (PGDB) was generated on 15-Feb-2024 from the annotated genome of Halothece sp. PCC 7418 PCC 7418, as … buttocks dimplingWebAug 12, 2024 · Halothece sp. PCC7418 (originally identified as Aphanothece halophytica 1; hereafter referred to as Halothece), isolated from the Dead Sea, is classified as a … cedar rapids iowa inmate searchWebClassification and research data for Halothece sp. PCC 7418, an unclassified species in the genus Halothece . Skip to main page content U.S. Department of Health and Human … buttocks cyst picturesWebThe cyanobacterium Halothece sp. PCC 7418 (hereafter referred to as Halothece) exhibits remarkable halotolerance and was used to examine stress-responsive regulatory mechanisms. The eects of ve dierent stimuli on Halothece transcriptomes were examined using RNA sequencing. buttocks enhancement injectionsWebStructure of Halothece sp. PCC 7418 CcmK4: Resolution: Method: X-RAY DIFFRACTION: Length: 117 Amino Acids: Molecular Weight: 12,602 Da: Organism: Halothece sp. … buttocks cushionWebJun 29, 2024 · Global transcriptome analyses and regulatory mechanisms in Halothece sp. PCC 7418 exposed to abiotic stresses. 15 September 2024 ... Fathalli A, Bellakhal M, Chomérat N, Masseret E, Laabir M, Turki S, Aleya L (2015) Alexandrium pacificum Litaker sp. nov (Group IV): resting cyst distribution and toxin profile of vegetative cells in Bizerte ... buttocks enhancement vacuum therapy